Protein Info for GFF5654 in Variovorax sp. SCN45

Annotation: L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 18 to 467 (450 residues), 574.9 bits, see alignment E=6e-177 PF12390: Se-cys_synth_N" amino acids 18 to 55 (38 residues), 28.9 bits, see alignment 2.5e-10 PF03841: SelA" amino acids 92 to 464 (373 residues), 518.5 bits, see alignment E=2.5e-159 PF01053: Cys_Met_Meta_PP" amino acids 141 to 316 (176 residues), 27.3 bits, see alignment E=3.4e-10 PF01212: Beta_elim_lyase" amino acids 144 to 376 (233 residues), 28 bits, see alignment E=3.6e-10 PF00266: Aminotran_5" amino acids 161 to 327 (167 residues), 24.6 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 55% identical to SELA_PSEE4: L-seryl-tRNA(Sec) selenium transferase (selA) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 59% identity to axy:AXYL_00323)

MetaCyc: 61% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>GFF5654 L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1) (Variovorax sp. SCN45)
MAAPEESVVHGSTARPQDLPSVDQLLRLAVPGALLAEHGRTLVVKEARALLEGLRAQAVA
GKLMAAEVQHDALGNALAARLQTRLAPRMKAVLNLTGTVIHTNLGRALLADAALQRLLAV
MTSPNNLEYDLATGSRGDRDSLVEELLCGITGAEAATVVNNNAAAVLLTIAALAREREVI
VSRGELVEIGGAFRMPDVMASAGARMVEVGTTNRTHPQDYERAINERTALVMKVHTSNYA
VQGFTAAVDEATLAGIAHARGVPLATDLGSGSLVDLAHYGLPREPLPQEMLAAGCDVVTF
SGDKLLGGPQAGLIVGSREAVGRIRKFPMKRALRMSKLPLAALEATLSLYLRPERLARDL
PTLRLLTRPADAIREMAESLKAPLQAAVSPRFTVEVVPLLGQIGSGSLPVERLPSAGLAL
APAGTSKKGIGTALDALATALRGLPLPVIGRIAEDRLLLDLRCLEDSAPFTGQLDILRER
LL