Protein Info for GFF5645 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 12, methionine/phosphonates) / ABC transporter, permease protein (cluster 12, methionine/phosphonates)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 18 to 263 (246 residues), 234.6 bits, see alignment E=6.3e-74 PF00528: BPD_transp_1" amino acids 94 to 260 (167 residues), 52.1 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 91% identity to vpe:Varpa_4730)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF5645 ABC transporter, permease protein (cluster 12, methionine/phosphonates) / ABC transporter, permease protein (cluster 12, methionine/phosphonates) (Variovorax sp. SCN45)
MTTTARALPSRPPPCWRCRLALLLIGAAVVASFVYLGIDYRALGSADSLKLMGKFITEFF
PPDMSPDFLAKVGKGALQTLAVSALGTVLAAIAGAVLALPASGRAGGALRHGSRFVLNFL
RSVPELVWAALMVLAAGIGPFAGALALALHTTGVLGRLFAEALENAPREPEHALTLSGAG
PIAAFSYASLPIVLPQWVAYALYRWEMNIRMAAVLGFVGGGGLGQLLYFHLSIFQQQQAM
TVLIAMFVLVTFVDFASVRLRRGLGPAYA