Protein Info for GFF5644 in Variovorax sp. SCN45

Annotation: Selenophosphate-dependent tRNA 2-selenouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR03167: tRNA 2-selenouridine synthase" amino acids 15 to 319 (305 residues), 350.1 bits, see alignment E=6.4e-109 PF00581: Rhodanese" amino acids 16 to 127 (112 residues), 38.2 bits, see alignment E=8.1e-14

Best Hits

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 92% identity to vpe:Varpa_4731)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF5644 Selenophosphate-dependent tRNA 2-selenouridine synthase (Variovorax sp. SCN45)
MSHRQPVRVGDRHAFDTLIDARSPAEFALDHIPGAINCPVLDDEERRIVGTVYVQTGAFE
ARRIGGAMVAANIARHLRDTLADRPENWKPLVYCWRGGMRSGSMVTWLRLVGWDAQQLAG
GYKSFRRHVISQIDALTPKLDLRVICGATGSAKTRVLHALAARGAQVLDLEDFASHKGSL
LGSLPGVPQPSQKHFETLIAAVLEGVDLSRPLYVEGESIRIGRLSLPLSLVARMRAAQCI
EVCATPEARLAYLLRDYAYLGDDRDALADKLGALKELQGKETVARWQQWAHEADLPHLFA
ELMALHYDPHYQKSQEVHFKAWAQRRGVSAADLSDQGIEAVAEAVLRLG