Protein Info for PS417_02870 in Pseudomonas simiae WCS417

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 51 to 153 (103 residues), 52.4 bits, see alignment E=6.8e-18 TIGR01778: TonB-dependent copper receptor" amino acids 54 to 689 (636 residues), 976.1 bits, see alignment E=5.1e-298 PF00593: TonB_dep_Rec_b-barrel" amino acids 207 to 647 (441 residues), 177.1 bits, see alignment E=1.2e-55

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 96% identity to pfs:PFLU0595)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC55 at UniProt or InterPro

Protein Sequence (689 amino acids)

>PS417_02870 TonB-dependent receptor (Pseudomonas simiae WCS417)
MSRFSADTRLGYTPVLAAFCGALLAPHVQADEHTEHELTPTVITAIAPSSPLTVITNPKD
PRQPVPASDGGDYLKTIPGFALVRNGGTNGDPVLRGMFGSRLNILTNGSMMLGACPGRMD
APTSYISPETYDKLTVIKGPQTVLWGPGASAGTILFEREPEEFGELGTRLNASVLAGSNG
RFDKVIDAAAGGPLGYVRVIGNQAHADDYKDGNNDTVASRYDKWNGDVAVGFTPDADTLL
ELTAGRGDGEARYAGRGMDGSQFLRESLGLRFEKSNIGDVLDKVEAQVYYNYADHVMDNY
SLRTPSGTGMMAGPMASNVDRRTLGARIKATWRWADVQLISGLDAQTNEHRQRSSMGIDT
YKDLPRVKDANFHNYGVFGELTWYAADRDRLITGARLDRASAKDFRQTSGSGMMKRPNPT
ADDTRADTLPSGFVRYEHDLADSPTTLYAGLGHSERFPDYWELFSPNTGATGSVNAFDGV
KPEKTTQLDFGAQYKADDLEAWASGYIGRVQDFILFDYRPGMMGTTSQARNVDARIMGGE
LGAAYKLTQNWKADATLAYAWGKNSSDGKALPQMPPLDARLGLTYSEDDWSAGALWRVVA
AQNRIDQNKGNVVGKDYDKSSGFGVFSLNAAYRVNKHFKVSTGVDNLFGKAYAEHLNLAG
NAGFGYPASDPQAIKEPGRTLWTKVDMTF