Protein Info for GFF564 in Sphingobium sp. HT1-2

Annotation: Sodium/bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details PF13593: SBF_like" amino acids 11 to 317 (307 residues), 309.9 bits, see alignment E=2.1e-96 PF01758: SBF" amino acids 42 to 217 (176 residues), 40.8 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 66% identity to nar:Saro_0247)

Predicted SEED Role

"Sodium - Bile acid symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF564 Sodium/bile acid symporter family (Sphingobium sp. HT1-2)
VLRRLFAFAEPFILALLSTVLLATLLPVRGVAAAIFDIITDIGIALLFFLHGAKLSRQAI
IDGARNLPLHLTVLATTFILFPLLGLALTHLPMLPPELAAGMLFLTLLPSTVQSSIAFTA
IARGNVAAAVCSASFSNLIGIVATPALVALLMNRTGSAAPLSFASVQSILLQLLLPFVVG
HMMHGRIGGFVHRHKKWVTLVDRGSILLVVYTAFSAAVVDGLWHAVSGEMLALLILLCCL
LLVIVMTATQALGKMMGFDQEDAIVLLFCGSKKSLASGVPMAGILFPVAQVGGIILPLIF
FHQIQLIACAIIARRFEHGAQPARA