Protein Info for GFF5635 in Variovorax sp. SCN45

Annotation: Molybdenum ABC transporter permease protein ModB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 18 to 221 (204 residues), 225.8 bits, see alignment E=2.2e-71 PF00528: BPD_transp_1" amino acids 34 to 222 (189 residues), 55.8 bits, see alignment E=2.6e-19

Best Hits

Swiss-Prot: 45% identical to YVGM_BACSU: Putative molybdenum transport system permease protein YvgM (yvgM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 97% identity to vpe:Varpa_4738)

MetaCyc: 41% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF5635 Molybdenum ABC transporter permease protein ModB (Variovorax sp. SCN45)
MNTTNSLIASTDWFPLVLSLKVAAVATVLALVMGVALGWVFARKRFFGRTVLEAVFMLPL
VLPPTVIGYAILVAAGRRSPLGAWLREHLDYTIIFSWHGAVVASAVVALPLVLKSASAAF
SGVDRSLEAAASTLRQSPFSVFLRVTLPLAWPGILAGTLLAFARAMGEFGASLMVAGSIP
KQTQTLSMAIYDAVQAGHDDLALLLVIVTSVLSITVLVLSNRFFSLR