Protein Info for GFF5620 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 225 to 227 (3 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 267 to 297 (31 residues), see Phobius details amino acids 303 to 331 (29 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 329 (279 residues), 118.4 bits, see alignment E=1.7e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to vap:Vapar_5009)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF5620 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MFYRENGQFKSSYRADQQIFPIAQDRIAILVLLLVAFVVVPLGVSDYWMRAILTPFLILS
LAALGLNILVGYCGQISLGTGAFMAVGAYAAYNFQVRIDGMPLIASLLLGGLCSTVIGVL
FGIPSLRIKGLYLAVATLAAQFFTDWAFLRIQWFTNNSSSGSVSVAGLNVFGVPIESPVQ
KYLFCLAFVVVFALLAKNLVRSAIGREWMAMRDMDVAAAVIGIRPVYAKLTAFAVSSFIV
GVAGALWGFVHLGAWEPAAFSIDRSFQLLFMVIIGGLGSIMGSFFGAAFIVLLPLFLNQL
PAWLGFSISTALASHLETMIFGALIVFFLIVEPHGLARLWSTAKEKLRLWPFPH