Protein Info for GFF562 in Sphingobium sp. HT1-2

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 380 (360 residues), 137.8 bits, see alignment E=4.2e-44 PF00083: Sugar_tr" amino acids 70 to 209 (140 residues), 35.4 bits, see alignment E=6.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>GFF562 Uncharacterized MFS-type transporter (Sphingobium sp. HT1-2)
MGQSETSWPARTAANWALLLLLLAYMLSFIDRIILSILIRPISADLHLSDMQFALVGGVA
FSLFYVSVGLPIGWLADRMPRRLIVAAGIALWSLCTVASGLAGSFGWLFLARVGVGIGEA
ALSPAAYSLIADYFPPAKRGRAVAIYTLGVSLGSSVAYLLGGLLIGFTATHGAVELPLFG
ALAPWRFVFVAVGVPGLFMALLTLTMREPARRSMPGGAIEEGIGFLAFLKARRSVSLAYI
LGYSFINLPFAGFILWGPALFDRLHGMGPRELSLPLALIFLVPTTLGQWFGALVTDRALA
RGHGDAAFRTGAACALLLVPVAIAMPLLTNATAALIALALLVFLVCASVGHHAVVAASVA
PNRLRGLYIALFFFVQNVMGQAIIALITAFLTDHIFGNPASIGRSMAIVGGIGAAGGFVA
LLAGRGALRQASPAVSQHP