Protein Info for GFF5592 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 215 to 234 (20 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 34 to 202 (169 residues), 81.4 bits, see alignment E=2e-26 PF13579: Glyco_trans_4_4" amino acids 36 to 195 (160 residues), 55.5 bits, see alignment E=2.2e-18 PF00534: Glycos_transf_1" amino acids 212 to 358 (147 residues), 104 bits, see alignment E=1.6e-33 PF20706: GT4-conflict" amino acids 220 to 335 (116 residues), 40.5 bits, see alignment E=4.4e-14 PF13692: Glyco_trans_1_4" amino acids 225 to 356 (132 residues), 112.5 bits, see alignment E=5.2e-36

Best Hits

KEGG orthology group: None (inferred from 62% identity to lch:Lcho_3607)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>GFF5592 Glycosyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTEVHSDQILVEEYPAGSPSMRLSVVTETWPPEINGVSLTLSKLVQGLCARNHQVQLIRP
RQTRADEALRHTGFEEVLMRGMPIPRYPELKLGLPGKRALIQAWTLKRPDLVHIATEGPL
GWSALQAARRLRLPVTSDFRTNFHAYSQHYGVGWLRKPIVAYLRKFHNLTRLTMVPTQAL
RAELMAGGFNHVQVVARGVDTQLFRPDRRSDALRAAWGATAGSLVLLVVGRLAAEKNLDM
ALRAFEAMRAAHPDVKLVFVGDGPLRESLRQRCPQAVFAGMQRHQELAAYYASADLFLFP
SLTETFGNVTIEALASGLPVLAFDTAAAADWVRHEGNGWLVPPGDDEAYPALAARLAREP
DGLVQARTLACAQVAQLDWQQIALQVEALFLQTLGTPAAPAVAARGHTLPAM