Protein Info for PS417_28540 in Pseudomonas simiae WCS417

Annotation: tRNA modification GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF10396: TrmE_N" amino acids 7 to 120 (114 residues), 139 bits, see alignment E=2.1e-44 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 456 (445 residues), 358 bits, see alignment E=8.9e-111 PF12631: MnmE_helical" amino acids 123 to 453 (331 residues), 197.4 bits, see alignment E=8.5e-62 TIGR00231: small GTP-binding protein domain" amino acids 217 to 349 (133 residues), 68.2 bits, see alignment E=7.5e-23 PF01926: MMR_HSR1" amino acids 218 to 311 (94 residues), 87.1 bits, see alignment E=2.2e-28 PF02421: FeoB_N" amino acids 218 to 309 (92 residues), 36.9 bits, see alignment E=6.6e-13

Best Hits

Swiss-Prot: 94% identical to MNME_PSEPF: tRNA modification GTPase MnmE (mnmE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 98% identity to pfs:PFLU6133)

MetaCyc: 67% identical to 5-carboxymethylaminomethyluridine-tRNA synthase GTPase subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UYM5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>PS417_28540 tRNA modification GTPase MnmE (Pseudomonas simiae WCS417)
MSAPRETIAAVATAQGRGGVGIVRISGPLASVAAKAISGRELKPRYAHYGQFLDADDSVL
DEGLAIYFPGPNSFTGEDVLELQGHGGPVVLDMLLQRCLQLGCRLARPGEFSERAFLNDK
LDLAQAEAIADLIEASSAQAARNALRSLQGAFSLRVHNLTEQLISLRIYVEAAIDFPEEE
IDFLADGHVLAMLDKVREELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGRE
AAIVTEIAGTTRDILREHIHIDGMPLHVVDTAGLRDTEDQVEKIGVERALKAIGEADRVL
LVVDATAPEAVDPFALWPEFLEQRPDPAKVTLIRNKADLTGEAIAMETSADGHVTISLSA
KAAGEGLELLREHLKACMGYEQTSESSFSARRRHLEALRHASAALEHGRAQLTLAGAGEL
LAEDLRQAQQLLGEITGAFSSDDLLGRIFSSFCIGK