Protein Info for PS417_28520 in Pseudomonas simiae WCS417

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 620 (614 residues), 921.2 bits, see alignment E=1.4e-281 PF01134: GIDA" amino acids 8 to 399 (392 residues), 581 bits, see alignment E=3.2e-178 PF12831: FAD_oxidored" amino acids 8 to 142 (135 residues), 30.8 bits, see alignment E=5e-11 PF21680: GIDA_C_1st" amino acids 460 to 554 (95 residues), 91.2 bits, see alignment E=1.5e-29 PF13932: SAM_GIDA_C" amino acids 556 to 624 (69 residues), 82.3 bits, see alignment E=5.6e-27

Best Hits

Swiss-Prot: 97% identical to MNMG_PSEF5: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 99% identity to pfs:PFLU6129)

MetaCyc: 69% identical to 5-carboxymethylaminomethyluridine-tRNA synthase subunit MnmG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UES2 at UniProt or InterPro

Protein Sequence (630 amino acids)

>PS417_28520 tRNA uridine 5-carboxymethylaminomethyl modification protein (Pseudomonas simiae WCS417)
MDFPSRFEVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGAMSCNPAIGGIGKSHLV
KEIDALGGVMAMATDKGGIQFRVLNSRKGPAVRATRAQADRILYKAAVRETLENQPNLWI
FQQAADDLIVEQDQVRGVVTQMGLRFFAESVVLTTGTFLGGLIHIGMQNYSGGRAGDPPS
IALAKRLRELPLRVGRLKTGTPPRIDGRSVDFSVMTEQAGDTPIPVMSFMGSKAQHPKQV
SCWITHTNARTHEIIAANLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKESHQVFIEPE
GLTTHELYPNGISTSLPFDVQIQIVQSIRGMENAHIVRPGYAIEYDYFDPRDLKYSLETK
VIGGLFFAGQINGTTGYEEAGAQGLLAGTNAALRAQGKDSWCPRRDEAYIGVLVDDLITL
GTQEPYRMFTSRAEYRLILREDNADLRLTEKGRELGLVDDVRWEAFCKKRESIALEEQRL
KSTWVRPGTEQGDAIAEKFGTPLTHEYNLLNLLSRPEIDYAGLVEVTGQGAEDPQVAEQV
EIKTKYAGYIDRQQDEIARLRASEDTKLPADIDYTGISGLSKEIQSKLGITRPETLGQAS
RIPGVTPAAISLLMIHLKKRGAGRQLEQSA