Protein Info for PS417_28515 in Pseudomonas simiae WCS417

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02527: GidB" amino acids 28 to 207 (180 residues), 207.1 bits, see alignment E=7.5e-66 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 34 to 211 (178 residues), 178.7 bits, see alignment E=4.6e-57

Best Hits

Swiss-Prot: 93% identical to RSMG_PSEF5: Ribosomal RNA small subunit methyltransferase G (rsmG) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 99% identity to pfs:PFLU6128)

MetaCyc: 47% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U685 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PS417_28515 16S rRNA methyltransferase (Pseudomonas simiae WCS417)
MSSLVTSQHAEELSTGARQLGVDLTPAQHELLLGYLALLIKWNKAYNLTAVRDPDEMVSR
HLLDSLSVMPFIENGRWLDVGSGGGMPGIPLAILFPGSQVTCLDSNGKKTRFLTQVKLEL
KLDNLQVIHSRVEAFTPEQPFTGIVSRAFSSMENFSNWTRHLGDRDTRWLAMKGVHPSDE
LLALPADFHLDSEHALAVPGCQGQRHLLILRRTA