Protein Info for PS417_28500 in Pseudomonas simiae WCS417

Annotation: ATP synthase F0F1 subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details PF03899: ATP-synt_I" amino acids 19 to 114 (96 residues), 72.6 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 83% identical to ATPZ_PSEPK: ATP synthase protein I (atpI) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02116, ATP synthase protein I (inferred from 98% identity to pfs:PFLU6125)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBG1 at UniProt or InterPro

Protein Sequence (135 amino acids)

>PS417_28500 ATP synthase F0F1 subunit I (Pseudomonas simiae WCS417)
METRTPNTLPFRRLAVFPVLLAQFVILLIAALALWYGHGVVAGYSGLCGGLIALLPNMYF
AHRAFRFSGARAAQAIVRSFYAGEAGKLILTAVLFALTFAGVKPLAPLAVFGVFVLTQLV
SWFAPLLMKTRLSKP