Protein Info for GFF5568 in Variovorax sp. SCN45

Annotation: SSU ribosomal protein S11p (S14e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR03632: ribosomal protein uS11" amino acids 15 to 131 (117 residues), 180.6 bits, see alignment E=5.8e-58 PF00411: Ribosomal_S11" amino acids 24 to 133 (110 residues), 166.5 bits, see alignment E=1.2e-53

Best Hits

Swiss-Prot: 100% identical to RS11_VARPS: 30S ribosomal protein S11 (rpsK) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 93% identity to ctt:CtCNB1_4430)

MetaCyc: 69% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>GFF5568 SSU ribosomal protein S11p (S14e) (Variovorax sp. SCN45)
MAKAPANNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGS
RKSTPFAAQVASEVAGRAAVEQGIKNLDVEIKGPGPGRESSVRALAALGIRINSIADVTP
VPHNGCRPQKRRRI