Protein Info for PS417_28490 in Pseudomonas simiae WCS417

Annotation: ATP synthase F0F1 subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details PF00137: ATP-synt_C" amino acids 10 to 72 (63 residues), 47.6 bits, see alignment E=7.9e-17 TIGR01260: ATP synthase F0, C subunit" amino acids 20 to 76 (57 residues), 99.9 bits, see alignment E=3.2e-33

Best Hits

Swiss-Prot: 100% identical to ATPL_PSE14: ATP synthase subunit c (atpE) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 95% identity to mpc:Mar181_3531)

MetaCyc: 57% identical to ATP synthase Fo complex subunit c (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase F0 sector subunit c"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3M0 at UniProt or InterPro

Protein Sequence (85 amino acids)

>PS417_28490 ATP synthase F0F1 subunit C (Pseudomonas simiae WCS417)
METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD
AVTMIGVGIALFFTFANPFVGQLAG