Protein Info for PS417_28480 in Pseudomonas simiae WCS417

Annotation: ATP synthase F0F1 subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00213: OSCP" amino acids 7 to 176 (170 residues), 178 bits, see alignment E=9.4e-57 TIGR01145: ATP synthase F1, delta subunit" amino acids 8 to 176 (169 residues), 162.3 bits, see alignment E=6.7e-52

Best Hits

Swiss-Prot: 95% identical to ATPD_PSEFS: ATP synthase subunit delta (atpH) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 94% identity to pba:PSEBR_a5655)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UNG3 at UniProt or InterPro

Protein Sequence (178 amino acids)

>PS417_28480 ATP synthase F0F1 subunit delta (Pseudomonas simiae WCS417)
MAELTTLARPYAKAAFEHAQAHQQLASWSAMLGLAAAVSQDDTMQRVLKAPRLTSADKAA
TFIEVCGDKFDVKVQNFIHVVAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQ
EQQDKLAKVLSARLDREVRLQVAEDKSLIGGIVIRAGDLVIDGSIRGKLANLAEALKS