Protein Info for PS417_02830 in Pseudomonas simiae WCS417

Annotation: urea ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 212 to 235 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 432 to 458 (27 residues), see Phobius details amino acids 466 to 485 (20 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 206 to 497 (292 residues), 439.6 bits, see alignment E=3.3e-136 PF02653: BPD_transp_2" amino acids 209 to 483 (275 residues), 153.2 bits, see alignment E=8.1e-49

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 95% identity to pfs:PFLU0587)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVS9 at UniProt or InterPro

Protein Sequence (500 amino acids)

>PS417_02830 urea ABC transporter permease (Pseudomonas simiae WCS417)
MLTALYRYILAALLLLPLGAHASDAEDFINANPTQQAKLLQDWAAQPDPARIELVDALQQ
GQLIVNGETKTVRLNNRLRGLIDNVHASQQLLAADPKVRLAAAQTLQKSAQPAQLKFLDQ
RVAAETDEGVHTALSLALANLQLVDTDPVVRLAAVRLLGSTGDPLARTRLEALLAPGVET
DAAVHTAAETSLAQVKRKLLVGEILGQAFSGMSLGSILLLAALGLAITFGLLGVINMAHG
EMLMLGAYSTYMVQLLMQRYMPQAIEFYPLIALPVAFFVTAAIGMALERTVIRHLYGRPL
ETLLATWGISLMLIQLVRLVFGAQNVEVSNPEWLSGGVQVLPNLVLPYNRIVIIAFALCV
VVLTWLLLNKTRLGLNVRAVTQNRNMAACCGVPTGRVDMLAFGLGSGIAGLGGVALSQIG
NVGPDLGQSYIIDSFLVVVLGGVGQLAGSVMAAFGLGIANKILEPQIGAVLGKILILALI
ILFIQKRPQGLFALKGRVID