Protein Info for PS417_28425 in Pseudomonas simiae WCS417

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 62 (28 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details PF01810: LysE" amino acids 15 to 204 (190 residues), 139.2 bits, see alignment E=5.9e-45

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfl:PFL_6202)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U950 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PS417_28425 lysine transporter LysE (Pseudomonas simiae WCS417)
MAELWLFLVALSVAYLLPGPDMILLLQTGARQGKALALTTAIGLGLARACHVALAGMGLA
TLFKVAPWTFDVVRLGGAAYLLWLGIQCLRASMLPPLDMANTPLAAHAWRAAFQRGLLTN
LLNPKALLFCSVLLPQFINPQAGPVAAQFALLGVILVAVGFVFDCCYALTGARIGQWLAR
NRSAQRMQQWLFGSLLIGFAVRLTFVQHA