Protein Info for GFF5553 in Variovorax sp. SCN45

Annotation: Pyrroline-5-carboxylate reductase (EC 1.5.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF03807: F420_oxidored" amino acids 19 to 111 (93 residues), 55.5 bits, see alignment E=7.2e-19 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 19 to 278 (260 residues), 252.9 bits, see alignment E=2e-79 PF14748: P5CR_dimer" amino acids 174 to 278 (105 residues), 121.3 bits, see alignment E=2.1e-39

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 90% identity to vpe:Varpa_5774)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF5553 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (Variovorax sp. SCN45)
MTIAVTFLPRTAPSPLPPVAFIGGGNMASAIIGGLIQQGSPAESFEVVEPFEEARAKLAQ
SFGIIAKAEAGEALSRCEVVVWAVKPQTFAEATRPVREFADGALQLSVAAGIPSDSIARW
LGTERVVRAMPNTPALVGKGMTGLFARAGVTGADRSLVGQLLAPTGELIWVDAEPALDAV
TAMSGSGPAYVFYFIEAMTEAGVEMGLTPDQAQRLAIGTFTGASALAHSATEPPSVLRAR
VTSKGGTTYAAITSLEAADVKAQFKTAIRAAQKRAAELGEEFGRG