Protein Info for PS417_28390 in Pseudomonas simiae WCS417

Annotation: CDP-alcohol phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 27 to 181 (155 residues), 30.3 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 96% identity to pfs:PFLU6105)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3K6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_28390 CDP-alcohol phosphatidyltransferase (Pseudomonas simiae WCS417)
MISIYQLKPRFQNLLRPLVQRLYDNGTTANQITVLAGVISLLVGLLIAGFAQHLWLFALI
PLWMILRMALNAIDGMLAREFGQQSRLGAYLNELCDVIADSALILPFALIPGVSLAPVLL
VALLAVFSEYAGVLGPMVGASRRYDGPMGKSDRAFVLGVLATGVALGWLGAGWVDTVMWL
VAALLAYTMVNRVRQGLKEQPETSPSA