Protein Info for PS417_28370 in Pseudomonas simiae WCS417

Annotation: cadmium ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 269 to 297 (29 residues), see Phobius details amino acids 567 to 589 (23 residues), see Phobius details amino acids 595 to 615 (21 residues), see Phobius details TIGR01525: heavy metal translocating P-type ATPase" amino acids 78 to 616 (539 residues), 523 bits, see alignment E=1.8e-160 TIGR01512: cadmium-translocating P-type ATPase" amino acids 78 to 618 (541 residues), 484.4 bits, see alignment E=6e-149 TIGR01494: HAD ATPase, P-type, family IC" amino acids 102 to 589 (488 residues), 198.9 bits, see alignment E=1.7e-62 PF00122: E1-E2_ATPase" amino acids 128 to 300 (173 residues), 171.4 bits, see alignment E=1.5e-54 PF00702: Hydrolase" amino acids 319 to 522 (204 residues), 66.9 bits, see alignment E=3.3e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU6101)

Predicted SEED Role

"Probable cadmium-transporting ATPase (EC 3.6.3.3)" in subsystem Cobalt-zinc-cadmium resistance (EC 3.6.3.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.3

Use Curated BLAST to search for 3.6.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEN6 at UniProt or InterPro

Protein Sequence (628 amino acids)

>PS417_28370 cadmium ABC transporter ATPase (Pseudomonas simiae WCS417)
MSAPMLTSAEQRSAARQLTLAMLALGLLVLGLAWRWLAPDQSGVSELLLGVASLLVAVPV
MRSAWYSLRFPSLHGITDQLIALAMLGAWATGDLLTAALLPIIMIFGHVLEERSVIGSQE
AIHALGKLTRSHARLVQADGSIVEVDNGTLNTGDVVEVRAGDRVPADGVVLSGQASLDTA
PITGESVPLEASVGVQVFGGAINLDGLLRLQVTRTGNESTLGKVIALMQNAERSKPPITR
LLERYAGSYMVLVLLLAAVTWFVTNDAQAMLAVLVAACPCALVLSAPATAIAGIAVAARH
GILIRSSAFLEELADLTSLVVDKTGTLTFGTLRLHSIETTAPDRQVLLNLAASLGSASSH
PVSRALAGLATQEQLLVLTDIRERQGLGVVAQTDRGEAALGRPELFEQLGITTTAVPNHD
GPIAGLALNGQFLAWLLLADSVKPEARQALQELRDLGLGRQLLLTGDRQSVANSLALEVG
ISDVEAQALPEDKLNRVLGEISNGFRPMVVGDGINDSLALKAGVVGVAMGAGGADIALAS
ADVVLIGSDLRRLGTCVRLSRQCRQTLQVNVIIGLGWTLAIVVFAAFGWLGAAGAMIAAV
LHNLSTLLVLGNAGRLLRFQEPLLKLEE