Protein Info for GFF5543 in Variovorax sp. SCN45

Annotation: FIG015373: Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 54 (26 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 102 to 107 (6 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details PF06149: DUF969" amino acids 8 to 223 (216 residues), 297.1 bits, see alignment E=3.7e-93

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_0696)

Predicted SEED Role

"FIG015373: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF5543 FIG015373: Membrane protein (Variovorax sp. SCN45)
MTPDIPLWPLIGVAVIIAGFILRFNPMLVVIVTAIVTAAAAGFGPMAILTAIGTGFIKTR
NLPLIILLPLAVIGLLERHGLRQHAQNWIGRIKSATAGRLLIVYLAARELTAAMGLTSLG
GHPQMVRPLLAPMAEGATETRYGKLPERLRHKLRAYAAATDNVGLFFGEDIFVAFGAIVL
MTTFLHEAGIDVEPLHVAMWGIPTAIAAFIIHSWRLRRLDQAIAREMEGTPGTDAPAVPA
TQEGR