Protein Info for GFF5540 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Protein containing domains DUF404, DUF407

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF04174: CP_ATPgrasp_1" amino acids 72 to 407 (336 residues), 496.9 bits, see alignment E=2.4e-153 PF14403: CP_ATPgrasp_2" amino acids 72 to 451 (380 residues), 542.5 bits, see alignment E=5e-167

Best Hits

Swiss-Prot: 52% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 87% identity to pol:Bpro_3157)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF5540 Protein containing domains DUF404, DUF407 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFDEMNASPSEVRAHYQNYARWLAQQPEDVMAARREEAEMIFRRVGITFAVYGAKDEDGS
GTERLIPFDLIPRIIPAHEWRSMEEGLVQRVTALNRFIHDVYHGQEIIKAGIVPADQIFQ
NAQFRPEMMGVDVPHQIYSHISGIDIVRAPNAEGVGEYYVLEDNLRVPSGVSYMLEDRKM
MMRLFPELFGENRVAPVAHYPDLLLETLRASSPATTAEPTVVVLTPGMYNSAYFEHAFLA
QQMGIELVEGQDLFVKDNFVYMRTTRGPKRVDVIYRRVDDDFLDPSVFRPTSTLGCEGLL
GVYRSGNVAICNAVGTGVADDKSIYPYVPKMIEFYLGQKPILNNVPTFMGREPEDLKYIM
ANMKDLVVKEVHGAGGYGMLVGPASTQAEIEDFRKAVAANPGGYIAQPTLSLSTCPTYVQ
SGVAPRHIDLRPFVLSGKEVQMVPGGLTRVALKEGSLVVNSSQGGGTKDTWILED