Protein Info for GFF554 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00005: ABC_tran" amino acids 54 to 197 (144 residues), 119.4 bits, see alignment E=3.6e-38 PF13304: AAA_21" amino acids 161 to 232 (72 residues), 30 bits, see alignment E=1.1e-10 PF08402: TOBE_2" amino acids 304 to 375 (72 residues), 30.1 bits, see alignment E=8.8e-11

Best Hits

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 83% identity to xau:Xaut_4408)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF554 Vitamin B12 import ATP-binding protein BtuD (Xanthobacter sp. DMC5)
VRARLKMMATREEAVLVDEIETLGMTRSRTPAAFAKGLSFEAVQLAYGDVAAVRGVSLAV
EPGEVLCLLGQSGCGKTSLLRLAAGIEQPDAGRILIDGEVVAGQGAFVPPERRGVGLVFQ
DYALFPHLTNLENVMFGLNGLKRAEAAREARLALARVDLADLAEVYPHELSGGQQQRVAL
ARAMAPRPGILLLDEPFSGLDRRLRDQVRAETLAVLRDAKATVIIVTHDPEEAMRLSDRI
ALLRKGELVQLGPPEELYRRPADLGVARFFCELNEIAAEVVGGMADTPIGRFAAPGLRDE
PAIVAIRPQGIALAPAGRGVAGRVLERRFLGELDLVEVIVEGVERPLVLRLRDAGNVKKG
DEVGLLVDPGEVLVFAAGRA