Protein Info for GFF554 in Variovorax sp. SCN45

Annotation: UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 21 to 216 (196 residues), 41.7 bits, E=1.9e-14
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 23 to 237 (215 residues), 213.3 bits, E=1.5e-67

Best Hits

Swiss-Prot: 45% identical to LPXH_BORPE: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 87% identity to vpe:Varpa_3509)

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.1.54

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Protein Sequence (258 amino acids)

>GFF554 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) (Variovorax sp. SCN45)
MNMVADPAFAELVAPPTWRTVDLISDLHLQAGEPATFEAWQGYLQTTPADALIILGDLFE
VWVGDDAAAQPGFEAQCAELLRRTAQRLPVYFMHGNRDFLVGSALAAQCGFTLLDDPTVL
VLHGQRWLLSHGDALCLEDTDYLKFRAQVRTPAWQAAFLARPLEERRALARSMRVQSEDR
KRDPSVVWADVDTAAARQWLQQAQAHVLVHGHTHRPADHDLGEGLRRIVLSDWDAAAHPP
RAQLLCLSSAGAQRVDLR