Protein Info for PS417_28350 in Pseudomonas simiae WCS417

Annotation: fatty acid methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF25371: DUF7884" amino acids 12 to 81 (70 residues), 44.1 bits, see alignment E=8.2e-15 PF02353: CMAS" amino acids 99 to 372 (274 residues), 361.3 bits, see alignment E=1.4e-111 PF05175: MTS" amino acids 151 to 232 (82 residues), 23.5 bits, see alignment E=1.5e-08 PF13489: Methyltransf_23" amino acids 153 to 268 (116 residues), 34.3 bits, see alignment E=8e-12 PF13847: Methyltransf_31" amino acids 160 to 241 (82 residues), 37.6 bits, see alignment E=7.3e-13 PF08242: Methyltransf_12" amino acids 164 to 260 (97 residues), 43.7 bits, see alignment E=1.5e-14 PF13649: Methyltransf_25" amino acids 164 to 259 (96 residues), 64.7 bits, see alignment E=4.2e-21 PF08241: Methyltransf_11" amino acids 164 to 261 (98 residues), 50.7 bits, see alignment E=9.1e-17

Best Hits

Swiss-Prot: 78% identical to FAMT_PSEPU: Probable fatty acid methyltransferase from Pseudomonas putida

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 98% identity to pfs:PFLU6097)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBD0 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PS417_28350 fatty acid methyltransferase (Pseudomonas simiae WCS417)
MLAQLPPALQNLQLPLRLRLWDGHEFNLGPEPSVTIVVKDPTVVTQLSHPTLDSLGEAFV
EGKLELEGSISEVIRVCDELSHALIADDEGSRPVRSIHDKATDAAAISYHYDLSNEFYQL
WLDQDMAYSCGYFETGSESIDQAQQDKFRHLCRKLRLQPGEYLLDVGCGWGGLARFAARE
FGVKVFGITLSREQLALARERVKAEGLEDQVDLQLLDYRDLPQDGRFDKVVSVGMFEHVG
HANLAEYCKILFGAVREGGLVMNHGITAKHTDGRPVGRGAGEFIERYVFPNGELPHLAMM
TAEISEVGLEVVDVESLRLHYARTLDHWSERLEDNLEAAAKMVPEQALRIWRLYLAGCAY
AFARGWINLHQILAVKPHADGSHDLPWTREDIYR