Protein Info for PS417_28325 in Pseudomonas simiae WCS417

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF01502: PRA-CH" amino acids 48 to 121 (74 residues), 120.5 bits, see alignment E=1e-39

Best Hits

Swiss-Prot: 78% identical to HIS32_PSEF5: Phosphoribosyl-AMP cyclohydrolase 2 (hisI2) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 90% identity to pfs:PFLU6092)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.19

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U929 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PS417_28325 phosphoribosyl-AMP cyclohydrolase (Pseudomonas simiae WCS417)
MTLSMLDLEGAAVGSRFPLEPVLDALPWNRDGLIAAIAQQHGSGEVLMLAWMNRQALKET
LDTGQVCYWSRSRQQLWRKGESSGHWQQLVEARLDCDGDAVLLIVDQQGTACHTGRPTCF
YNAIDGDYVHIITEPLA