Protein Info for PS417_28315 in Pseudomonas simiae WCS417

Annotation: zinc ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 49 to 90 (42 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 162 (32 residues), see Phobius details amino acids 183 to 215 (33 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF00950: ABC-3" amino acids 15 to 272 (258 residues), 171 bits, see alignment E=1.8e-54

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 99% identity to pfs:PFLU6090)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U647 at UniProt or InterPro

Protein Sequence (288 amino acids)

>PS417_28315 zinc ABC transporter permease (Pseudomonas simiae WCS417)
MHFAAHLWMPFVDFVFMRRALIGGLVLACSTAPLGVFLILRRMSLIGDAVAHGILPGAAL
GFWFAGLSLPALTIGGLGAGLSMAGLSAWITRRTGLREDASLAAIYPISLAAGVLILGLA
GKRLDLLHLLFGSALAVDGTTLTGMLWVSSFSLIAMAVIYKPLLLDTLDPLFLQTVSRLG
PLAHGLFLTLVVLNLVIGFQAIGALMVVGLMMLPAIASRFWSRRLPVLIAVSAVLGCLSV
WLGLLLSFYYSLPSGPAIVLVAGAGYLLSVVFGPVHGLLRRPPLLSSQ