Protein Info for GFF553 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ATP-dependent hsl protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 444 (441 residues), 663.5 bits, see alignment E=8.2e-204 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 22.6 bits, see alignment 2.8e-08 PF00004: AAA" amino acids 53 to 100 (48 residues), 28.7 bits, see alignment 4.9e-10 amino acids 232 to 333 (102 residues), 32.4 bits, see alignment E=3.5e-11 PF07724: AAA_2" amino acids 184 to 330 (147 residues), 101 bits, see alignment E=2.3e-32

Best Hits

Swiss-Prot: 84% identical to HSLU_ACIET: ATP-dependent protease ATPase subunit HslU (hslU) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 84% identity to dia:Dtpsy_2990)

MetaCyc: 67% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF553 ATP-dependent hsl protease ATP-binding subunit HslU (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSMTPQEIVSELDRFIIGQKGAKRAVAIALRNRWRRQQVDEKLRPEITPKNILMIGPTG
VGKTEIARRLARLADAPFIKVEATKFTEVGYVGKDVDSIIRDLAEIAVKQTREVEMRKQR
VRAEDAAEDRILDVLIPPPRGMAGEPSAVATPEGTARQNFRKKLREGQLDDRDIEIDLAE
ARPSMEIMGPAGMEEMAEQLRGMFSQMGAGKRQTRKLKIAEAMKLLIDEEAAKLVNEEEI
KTRALHSAEQNGIVFIDEIDKVTSRSDAGGAEVSRQGVQRDLLPLVEGTTVSTKYGVVKT
DHILFIASGAFHLARPSDLIPELQGRFPIRVELQSLSVEDFEAILTQTHASLVKQYQELL
ATEGVTLDFAPDGIRRLAQIAFDVNERTENIGARRLSTVMEHLLDEVSFDATRLQGQTIA
IDAAYVDARLGELSRNEDLSRYIL