Protein Info for PS417_28235 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 957 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 304 to 401 (98 residues), 32.4 bits, see alignment E=9.1e-12 amino acids 400 to 523 (124 residues), 57.8 bits, see alignment E=1.2e-19 PF08447: PAS_3" amino acids 305 to 388 (84 residues), 70.1 bits, see alignment E=5.4e-23 amino acids 426 to 510 (85 residues), 28.3 bits, see alignment E=6.3e-10 PF13188: PAS_8" amino acids 407 to 449 (43 residues), 27.4 bits, see alignment (E = 8.5e-10) PF00989: PAS" amino acids 407 to 513 (107 residues), 38.7 bits, see alignment E=3.3e-13 PF08448: PAS_4" amino acids 409 to 519 (111 residues), 48.1 bits, see alignment E=4.5e-16 PF13426: PAS_9" amino acids 414 to 515 (102 residues), 47.9 bits, see alignment E=5.1e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 527 to 686 (160 residues), 106.4 bits, see alignment E=1.3e-34 PF00990: GGDEF" amino acids 529 to 684 (156 residues), 140.7 bits, see alignment E=1.3e-44 PF00563: EAL" amino acids 705 to 940 (236 residues), 254.7 bits, see alignment E=2.6e-79

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU6074)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3I1 at UniProt or InterPro

Protein Sequence (957 amino acids)

>PS417_28235 diguanylate cyclase (Pseudomonas simiae WCS417)
MTFSTDLLGPSAAPAQVLRKHYATEMAVERTRLLYQGSLLPTLLMLVNGLVCAWLLWNPK
QYLLDSIWLVWLLALVAMRVIQVAAFDSAMPSRQAQPVWRRMFMLGSAVSGLTLATAAIA
LVPVDSFMQQAWVFGLIGAATLSASVAYAVSLPAFLSFALPCLVPAILYLFWTGDPQQRG
WGVLGLILLASLSLVAWQVNRLIQRGLLRRFQNQALIEHLQQAQQRSEQLNQELVREVEQ
RRQVEHELREAQVGLQDRVAQRSQELDATHLALNKSEARLAMALQASELGLWDWNLQTDE
VHHTQLKELFGLEPEYVTAMLSHLKPRLHPDDLPLLKRALVEHLKGRSEDYQVEYRVRHG
DGHWVWIEDRGRAVERAPSGRVTRMLGTRRDITAGKALEEQQRLASTVFEAASEGIVILD
PDYKLIAVNQAFSRVTGFETDDMIGRNVVELPSSRDARRHFPVIRQALLSHGTWQGELVE
TRKNGELYPQWLQLNVVRDVRGKVSHIVGFFADLSARRESEERMRYLTHYDELTGLANRS
LFRERLREAHQRVRQGGRNLALLHINLDRFKLLNDSLGHEVADQLLQKMARRLINALPEA
DTIARLSGDEFAVLFDAYGNLSSLARVATRLLAKLRVPVTVEGHELVVSASMGVSLLPDN
AREISALVSQSNMAMQHAKHLGGNNFQFYTDSLQASTLERLQLENHLRKAIEEGQLTVFY
QPKLCLATGKLNAAEALIRWEHPQWGMVPPGDFIGLAEETGLIVPLGEFVLREACWQACE
WQRQGLAPIRVSVNLSVHQLRQGKLVSLVRQVLEETGLDPQYLELELTESQLLDSVEHII
ATFQQLRDLGVKLAIDDFGTGYSSLSYLKRIPVDYVKIDQTFIRGLGQGREDAAITRAII
AMAHGLALKVVAEGVEDQQQLDFLRGERCDEVQGYLISRPMEAKGLADLLRKNADFP