Protein Info for PS417_28215 in Pseudomonas simiae WCS417

Annotation: pyruvate carboxylase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00289: Biotin_carb_N" amino acids 1 to 109 (109 residues), 149.5 bits, see alignment E=1.2e-47 PF02786: CPSase_L_D2" amino acids 114 to 320 (207 residues), 243.4 bits, see alignment E=4.4e-76 PF02222: ATP-grasp" amino acids 138 to 291 (154 residues), 33.4 bits, see alignment E=9e-12 PF07478: Dala_Dala_lig_C" amino acids 147 to 289 (143 residues), 41.5 bits, see alignment E=2.8e-14 PF02785: Biotin_carb_C" amino acids 334 to 440 (107 residues), 136.9 bits, see alignment E=7.1e-44

Best Hits

Swiss-Prot: 54% identical to 2OCS_HYDTT: 2-oxoglutarate carboxylase small subunit (cfiB) from Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)

KEGG orthology group: K01959, pyruvate carboxylase subunit A [EC: 6.4.1.1] (inferred from 99% identity to pfl:PFL_6158)

MetaCyc: 53% identical to pyruvate carboxylase subunit A (Methanothermobacter thermautotrophicus Delta H)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1

Use Curated BLAST to search for 6.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEK5 at UniProt or InterPro

Protein Sequence (471 amino acids)

>PS417_28215 pyruvate carboxylase subunit A (Pseudomonas simiae WCS417)
MIKKILIANRGEIAVRIVRACAEMGIRSVAVYSDADRHALHVKRADEAHSIGAEPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELADICAERGIKFIGPSAEVIRRMGDKTEARR
SMIKAGVPVTPGTEGNVADIHEALTEGDRIGYPVMLKATSGGGGRGIRRCNSREELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLSVRAAKAVGYENAGTVEFLLAEGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLPLSVKQEDIQHRGFALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPFYDSMCLKLVVWALTWEEAMDRGLRALDDMRLQGVKTTAAYY
QEILRNPEFRSGQFNTSFVESHPELTNYSIKRKPEELALAIAAAIAAHAGL