Protein Info for GFF5511 in Variovorax sp. SCN45

Annotation: FIG000875: Thioredoxin domain-containing protein EC-YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00085: Thioredoxin" amino acids 4 to 108 (105 residues), 78.7 bits, see alignment E=9e-26 PF13098: Thioredoxin_2" amino acids 20 to 106 (87 residues), 31.1 bits, see alignment E=7.7e-11 PF13432: TPR_16" amino acids 123 to 171 (49 residues), 21.2 bits, see alignment 9.8e-08 amino acids 210 to 250 (41 residues), 16.3 bits, see alignment 3.3e-06 PF14559: TPR_19" amino acids 128 to 183 (56 residues), 39.2 bits, see alignment E=2.2e-13 PF14561: TPR_20" amino acids 207 to 303 (97 residues), 59.8 bits, see alignment E=8.2e-20

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 96% identity to vpe:Varpa_5812)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF5511 FIG000875: Thioredoxin domain-containing protein EC-YbbN (Variovorax sp. SCN45)
MIDITLENFQAELIEGSVAAPVLLDIWAEWCGPCKQLGPVLEKLEVEYAGRFTLAKLDAD
KVPQISSQLSEMFGVRSIPFCVMFKDGQPVDGFVGAIPAEKIREFLDKHVPGADEAEAAS
EEAAAQEALAGGDTQGALEKLQHAVATDPANDDARFDYIKLLLQEGRHDDAKVAFAPVIA
KTTLVRRFDALQRWMDAIDFAAPPTGAAPAIADFDAKIAASKRDFDARFGRARLLMAAQR
WTDAMDELLDILMRDKSWSEDLARKTYIAILDLIEPPKVKVADGQIPPDDPVVATYRRRL
SSVVLS