Protein Info for GFF5507 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tripartite ATP-independent periplasmic transporter, DctQ component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details PF04290: DctQ" amino acids 22 to 150 (129 residues), 72.3 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: None (inferred from 71% identity to pna:Pnap_0045)

Predicted SEED Role

"Tripartite ATP-independent periplasmic transporter, DctQ component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF5507 Tripartite ATP-independent periplasmic transporter, DctQ component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKSTQFLKHGAEALLALCLAGMVVCVFANVVLRYGFDSGINATEELSRLLFVWMVFLGAT
AAYPLGQHMAFTSLVGSLRDRPRAFAFATLAIRLLVLLACVLLGRGAWQQVVVGMDSHSV
VLGYPVALLPLPALLCSLAIGAMVLIEIVRRTPLDLGHAVDME