Protein Info for PS417_28155 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02030: Lipoprotein_8" amino acids 9 to 104 (96 residues), 22.8 bits, see alignment E=7.6e-09 PF01547: SBP_bac_1" amino acids 35 to 296 (262 residues), 61 bits, see alignment E=4e-20 PF13416: SBP_bac_8" amino acids 38 to 327 (290 residues), 107.8 bits, see alignment E=1.8e-34 PF13343: SBP_bac_6" amino acids 74 to 317 (244 residues), 55.4 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 60% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 96% identity to pfs:PFLU6062)

MetaCyc: 56% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHF0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PS417_28155 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MNMLKSLVLCAAVISGMAHAEEKTLRVYNWFDYITPKALEDFKAQNPTIKLVYDIFDTNE
ALEAKLLTGNAGYDVVVPSNVFLAKQIEAGVFQPLDRSQLQNWKHLDPKLMKLIEANDPG
NKFAVPYMYGTILIGFNPDKVKAALGVNAPVDSWDLIFKEENISKLKQCGVALLDSPSEI
LPLALQHLGLDPNSSNPKDYAKAEALLLKIRPYVTYFHSSKYMADIANGDICVAVGYSGS
FSQAANRARDAKNGVTVDMRLPKEGAPIWFDMLAIPKGAKNPQDAYTFINYLLQPQVIAP
ISDFVGYPNPNKDATEQVDPSIRNNPNLYPTEAAMATLYTLKPLGRDAERARTRAWSKIK
SGI