Protein Info for PS417_02800 in Pseudomonas simiae WCS417

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF13302: Acetyltransf_3" amino acids 2 to 135 (134 residues), 47.7 bits, see alignment E=8.3e-16 PF13420: Acetyltransf_4" amino acids 2 to 154 (153 residues), 47.6 bits, see alignment E=5.7e-16 PF00583: Acetyltransf_1" amino acids 14 to 135 (122 residues), 70 bits, see alignment E=6.7e-23 PF13673: Acetyltransf_10" amino acids 49 to 140 (92 residues), 32.2 bits, see alignment E=2.9e-11 PF13508: Acetyltransf_7" amino acids 52 to 136 (85 residues), 36.6 bits, see alignment E=1.5e-12 PF08445: FR47" amino acids 83 to 137 (55 residues), 31.5 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 74% identical to MDDA_PSEA7: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (PSPA7_5587) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 96% identity to pfs:PFLU0581)

MetaCyc: 66% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UF92 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PS417_02800 acetyltransferase (Pseudomonas simiae WCS417)
MIRDATQNDLPAIRDIYNDAVLNTTAIWNEQPADLGNRQAWFSARHALGYPILVSVENGE
VTGYASFGDWRPFEGFRYSVEHSVYVRSDQRGKGLGPLLMEALIERARACGKHVMVAAIE
SGNQASIRLHERQGFITTGQMPQVGIKFGRWLDLTFMQLALNPGAEPPKE