Protein Info for PS417_28115 in Pseudomonas simiae WCS417

Annotation: phosphoribosylaminoimidazole carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to PURK_PSEAE: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 99% identity to pfs:PFLU6054)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
inosine-5'-phosphate biosynthesis I (6/6 steps found)
inosine-5'-phosphate biosynthesis II (5/5 steps found)
inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEI7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PS417_28115 phosphoribosylaminoimidazole carboxylase (Pseudomonas simiae WCS417)
MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAALGEHLRADYSDPDHLRQLADE
VDLVTFEFESVPAETVAFLSQFVPVYPSAEALRIARDRWFEKSMFKDLGIPTPAFADIQS
QADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTEADVVGTFAELGSVACLLEGFVPFTG
EVSLIAVRARDGETRFYPLVHNTHDSGILKLSVASTDHPLQALAEDYSSRVLKQLDYVGV
MAFEFFEVDGGLKANEIAPRVHNSGHWTTEGAECSQFENHLRAVAGLPLGSTAKVGESAM
LNFIGTVPAVEKVIAIDDCHLHHYGKAFKAGRKVGHANLRCKDRATLEAQILKVEALIAE
Q