Protein Info for GFF549 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 172 (156 residues), 54.6 bits, see alignment E=5.1e-19 PF04542: Sigma70_r2" amino acids 20 to 82 (63 residues), 42.2 bits, see alignment E=8.2e-15 PF08281: Sigma70_r4_2" amino acids 119 to 170 (52 residues), 43.4 bits, see alignment 3.2e-15 PF20239: DUF6596" amino acids 188 to 287 (100 residues), 114.2 bits, see alignment E=4.9e-37

Best Hits

Swiss-Prot: 69% identical to Y370_RHIME: Uncharacterized protein R00370 (R00370) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 86% identity to xau:Xaut_4187)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF549 hypothetical protein (Xanthobacter sp. DMC5)
MTTPAITDPDWINGTLTAARPQAVAALLRYFRDLDTAEEAFQEACLRALRTWPVNGPPRD
PAAWLILVGRNAALDGVRKRAKHDPLPPDDQLSDLDDAEAPLAERLDNSHYRDDVLRLLF
ICCHPELPATQQIALALRIVSGLTVKEIARAFLVSEAAMEQRITRAKARIARADVPFEAP
GPVERAERLGTVAAMVYLVFNEGYSAGGEPSRAGLCDDAIRLGRLLLRLFPTEPEIMGLL
ALMLLQHARAAARFDPDGRAILLDRQDRAKWDRERIAEGLALVDKAMRHRRPGTYQIQAA
VAGLHSRAATPEETDWAQIDALYAALEFLQPSPVVTLNRAVAVSKVKGAEAALAMIEPLA
PQLAGYFHFFGARGAFLLELGRQQEARVAFDRAIALANTPAEAEHIRAQIDLIQSLA