Protein Info for GFF5481 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ortho-halobenzoate 1,2-dioxygenase alpha-ISP protein OhbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00355: Rieske" amino acids 48 to 134 (87 residues), 66 bits, see alignment E=2.3e-22 PF00848: Ring_hydroxyl_A" amino acids 206 to 421 (216 residues), 63.2 bits, see alignment E=3.2e-21

Best Hits

Swiss-Prot: 78% identical to NAGG_RALSP: Salicylate 5-hydroxylase, large oxygenase component (nagG) from Ralstonia sp.

KEGG orthology group: K05708, large terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 91% identity to pol:Bpro_0983)

MetaCyc: 78% identical to salicylate-5-hydroxylase large subunit (Ralstonia sp. U2)
RXN-10446 [EC: 1.14.13.172]

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase alpha-ISP protein OhbB" in subsystem Benzoate degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.19 or 1.14.13.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF5481 Ortho-halobenzoate 1,2-dioxygenase alpha-ISP protein OhbB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTTTAPEGTFPEQLRWESDGTSRIPFMAYTGAELHKKELERFFYTKHWNYVGLEAEVPN
AGDYKRTVVGERSVIMVRDADGGISVVENVCAHRGMQFCRERHGNKKEFVCPYHQWSYTL
KGDLQGVPFRRGVKQDGKVNGGMPADFKTADHGLNKLKVATRGGVVFASFDHGVESLEDF
MGPAILGYFDRLFNGRKLTILGYNRQRIPGNWKLMQENIKDPYHPGLLHTWFVTFGLWRA
DNKSELKMDDRHRHAAMISTRGQSGKAEQVTQVSSFKESMQLHDPRFLDIVPEPWWEGPT
AVMMTLFPSVILQQQVNSVSTRHIQPDGHGAFDFVWTHFGFEDDSEEMTQRRLRQANLFG
PAGFVSADDGEVIEFSQQGFEQKPYHRTLAELGGREVGDTDHMVTETLIRGMYAYWREVM
EA