Protein Info for GFF548 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF13458: Peripla_BP_6" amino acids 5 to 327 (323 residues), 179.6 bits, see alignment E=2.1e-56 PF13433: Peripla_BP_5" amino acids 5 to 344 (340 residues), 61 bits, see alignment E=1.7e-20 PF01094: ANF_receptor" amino acids 28 to 339 (312 residues), 82.7 bits, see alignment E=4.2e-27

Best Hits

Swiss-Prot: 100% identical to LIVK_SALTI: Leucine-specific-binding protein (livK) from Salmonella typhi

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to set:SEN3387)

MetaCyc: 93% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF548 High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQA
VAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTA
GLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAG
EKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARANGLKTQFMGPEGVGNASLSNIAG
GAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHA
PLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK