Protein Info for PS417_28020 in Pseudomonas simiae WCS417

Annotation: chorismate--pyruvate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 163 to 180 (18 residues), see Phobius details PF04345: Chor_lyase" amino acids 13 to 178 (166 residues), 169 bits, see alignment E=3.8e-54

Best Hits

Swiss-Prot: 75% identical to UBIC2_PSEPF: Probable chorismate pyruvate-lyase 2 (ubiC2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 92% identity to pfs:PFLU6035)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UN21 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PS417_28020 chorismate--pyruvate lyase (Pseudomonas simiae WCS417)
MPHSIDSSDACQWLTQSLLHPAPAPLTLNWLFNEDSLTRRLTWLSSDGFSVTPLFEGWQP
LRDDECAALALAPATIGWVREVYLRGQGQPWVFARSVAARSALQGDGLHMDELGSRSLGE
LLFCDQAFTRQAIEVCHYPRQWLPTTVQTDGLWARRSRFDRGSLSVLVAEIFLPSFWHAL
HAHPENC