Protein Info for PS417_27980 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 878 (866 residues), 1277.2 bits, see alignment E=0 PF13191: AAA_16" amino acids 211 to 312 (102 residues), 33.8 bits, see alignment E=2.4e-11 PF00004: AAA" amino acids 234 to 367 (134 residues), 36.4 bits, see alignment E=3.3e-12 amino acids 627 to 713 (87 residues), 27.6 bits, see alignment E=1.8e-09 PF17871: AAA_lid_9" amino acids 373 to 465 (93 residues), 101.7 bits, see alignment E=9.6e-33 PF07724: AAA_2" amino acids 621 to 787 (167 residues), 181.5 bits, see alignment E=6.7e-57 PF07728: AAA_5" amino acids 626 to 740 (115 residues), 35.4 bits, see alignment E=5.1e-12 PF10431: ClpB_D2-small" amino acids 794 to 868 (75 residues), 49.9 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 88% identical to CLPV1_PSEAE: Protein ClpV1 (clpV1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 98% identity to pfs:PFLU6025)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3D7 at UniProt or InterPro

Protein Sequence (892 amino acids)

>PS417_27980 ATPase AAA (Pseudomonas simiae WCS417)
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQF
NVEPARLARDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLG
ILKTPSLRHALLGLSSEFDKIKAEALSERFDEYVGDSPENALSASDGFNAGAVPGEASGA
MAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLVDILMRRRQNNPILTGEAG
VGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGASMKGEFEQRLRQVIEDVQAS
PKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYKKHIEKDPAL
TRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIAIGARQTNTETL
LSAERERLETLESRWAEEKALVDELLATRATLREKVGVVDSPAGNNESDELRAQLVDLQQ
RLTALQGETPLILPTVDYQAVASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDH
ALQMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMS
EFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFD
KGVMEDGEGRVIDFKNTLILLTTNAGTELISQVCKDPANVPEPEEIAKALRQPLLEIFPP
ALLGRLVTIPYYPLSDEMLKAITRLQLNRIKKRVETTHKVAFDYDDAVVDLIVSRCTETE
SGGRMIDTILTNSLLPDMSREFLTRMLEGKALAGVRISSRDNELHYDFSDAD