Protein Info for GFF546 in Sphingobium sp. HT1-2

Annotation: Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR03215: acetaldehyde dehydrogenase (acetylating)" amino acids 5 to 308 (304 residues), 456.1 bits, see alignment E=2.3e-141 PF01118: Semialdhyde_dh" amino acids 7 to 120 (114 residues), 31.1 bits, see alignment E=2.8e-11 PF09290: AcetDehyd-dimer" amino acids 131 to 284 (154 residues), 198.7 bits, see alignment E=4.7e-63

Best Hits

Swiss-Prot: 72% identical to ACDH3_PARXL: Acetaldehyde dehydrogenase 3 (Bxeno_B0694) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 72% identity to bxe:Bxe_B2326)

MetaCyc: 70% identical to acylating aldehyde dehydrogenase (Pseudomonas putida F1)
Acetaldehyde dehydrogenase (acetylating). [EC: 1.2.1.10]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF546 Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol (Sphingobium sp. HT1-2)
VAQKRMKVAIIGSGNIGTDLMIKVMRQSDVLEMSALVGIDPQSDGLARAARMGVATTHEG
MDGLQRLDVWSQIGLVFDATSAGAHPQHSTIVTGAGKAMIDLTPAAIGPYVIPVVNGDAH
LDAANVNMVTCGGQATIPIVAAISAVATVHYAEIVASIASKSAGPGTRANIDEFTETTSR
AIEEVGGAHKGKAIIVLNPAEPPMLMRDTVFVLSSGASEAEIAAAVEAMVARVAAYVPGY
RLKQQVQFERFGANNPVQIPGLGQFEGIKSTIFLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKIAARRLLQEAV