Protein Info for GFF545 in Sphingobium sp. HT1-2

Annotation: 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03217: 4-hydroxy-2-oxovalerate aldolase
  • amino acids 9 to 340 (332 residues), 567.2 bits, E=6e-175
• PF00682: HMGL-like
  • amino acids 10 to 267 (258 residues), 201.9 bits, E=1.3e-63
• PF07836: DmpG_comm
  • amino acids 278 to 339 (62 residues), 109.9 bits, E=3.4e-36

Best Hits

Swiss-Prot: 84% identical to HOA3_SPHWW: 4-hydroxy-2-oxovalerate aldolase 3 (Swit_4923) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 84% identity to swi:Swit_4923)

MetaCyc: 73% identical to 4-hydroxy-2-oxovalerate aldolase (Pseudomonas putida)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• catechol degradation I (meta-cleavage pathway) (3/5 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• catechol degradation II (meta-cleavage pathway) (3/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (3/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (3/7 steps found)
• meta cleavage pathway of aromatic compounds (5/10 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
• p-cumate degradation (3/8 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• p-cymene degradation (3/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.39

Protein Sequence (345 amino acids)

>GFF545 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (Sphingobium sp. HT1-2)
MPFDPTETKLYIQDVTLRDGMHAIRHQYGLDHVQAIARALDVAKVDAIEVSHGDGLNGSS
FNYGFGRHTDWEWIEAVADVLDHSVLTTLLIPGIGTIEDLKHAHGLGVRSVRVATHCTEA
DVARQHIGAARDLGMDVSGFLMMSHMIDPDALAQQARLMESYGAHCIYVTDSGGALDMDG
YRARCEAYDRVLKPETQRGIHAHHNLSLGVANSIVGVQAGAIRVDASLAGMGAGAGNAPL
EVFIAAAARKGWNHGCDLYRLMDAAETLVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAE
KASADYGIDTREILVELGRRRMVGGQEDMIVDVALDLARASARTA