Protein Info for GFF5446 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 307 to 432 (126 residues), 64.3 bits, see alignment E=5.7e-22 PF00989: PAS" amino acids 308 to 424 (117 residues), 38.7 bits, see alignment E=2.8e-13 PF13188: PAS_8" amino acids 309 to 350 (42 residues), 23.3 bits, see alignment 1.3e-08 PF08448: PAS_4" amino acids 322 to 429 (108 residues), 27.9 bits, see alignment E=7e-10 PF13426: PAS_9" amino acids 324 to 426 (103 residues), 43.3 bits, see alignment E=1.1e-14 PF00512: HisKA" amino acids 451 to 518 (68 residues), 29.9 bits, see alignment E=1.4e-10 PF02518: HATPase_c" amino acids 563 to 682 (120 residues), 75 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: K11711, two-component system, LuxR family, sensor histidine kinase DctS [EC: 2.7.13.3] (inferred from 92% identity to vpe:Varpa_5873)

Predicted SEED Role

"two-component hybrid sensor and regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>GFF5446 Two-component system sensor histidine kinase/response regulator hybrid (Variovorax sp. SCN45)
MPDALLTVAPRRWALIAFARLRSLWQRWFLWLLLAVLVSALLVTVVWLAGRHEVEQVQAS
LDRDTADAVSDLRSGFQRNAQSLRATQAPGANLGQWSDIAASLLREHREWLRLEWRDAAL
RPLQAVNTPYRMRILDEASRGPEQSDVTLACAAARKLGAPAYSPSHYVPVAGGGGVEVME
LCVPIDAGGYLVASYSLRDALIELVGPTLTRGQEVAFTEADGTRLVALGTSRRTGTRVFT
SQQLIDLPGTALMLRVDGWRAAPDLFPNMLTALVTAISIALVSVLVLLARDTRRRLRAER
DLADALAFRKAMEDSVITGLRARDLQGRITYVNPAFCEMVGFSPEELMAGNAEAPDAPYW
PTELAHEYQQRQARRLAGGMPPREGFESVFMRKDGTRFPVLIFEAPLINAHKVQTGWMSA
FIDVSEQRRIEELSRASQERLQASARLATVGEMASLLSHELTQPLAAIASYASGSLNLLG
PHARGDQGEVAMAVRRIAEQADRAGQVIRSVHDFVRRRDRTREPVAPQALIDAVLPLVRL
QARKLGVIIEVVFEDRLPAAMCDRTLVEQVLLNLARNAMQAMDSPDNVGSRVLRLRVARA
AAVGGTVQEDGRRWLEFSVADLGCGISDEVAERLFTPFFTTRADGMGLGLSLCRTVVEQH
GGALVFEPNKPRGTVFRFTLPAAG