Protein Info for GFF5442 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Enolase (EC 4.2.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01060: phosphopyruvate hydratase
  • amino acids 4 to 426 (423 residues), 682.3 bits, E=1.1e-209
• PF03952: Enolase_N
  • amino acids 4 to 133 (130 residues), 199 bits, E=3.2e-63
• PF00113: Enolase_C
  • amino acids 141 to 425 (285 residues), 443.5 bits, E=3.8e-137

Best Hits

Swiss-Prot: 92% identical to ENO_ACISJ: Enolase (eno) from Acidovorax sp. (strain JS42)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 91% identity to ctt:CtCNB1_1128)

MetaCyc: 64% identical to enolase subunit (Streptococcus mutans)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• gluconeogenesis III (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• chorismate biosynthesis I (7/7 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• homolactic fermentation (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• gallate biosynthesis (2/3 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• heterolactic fermentation (12/18 steps found)
• quinate degradation I (1/3 steps found)
• quinate degradation II (1/3 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Protein Sequence (428 amino acids)

>GFF5442 Enolase (EC 4.2.1.11) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAIVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYL
GKGVLKAVENINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKGRLGANAMLAVSMAVAR
AAAEEAGLPLYRYFGGMSAVQMPVPMMNIINGGAHANNSLDLQELMIIPVGAPSFREALR
WGAEVFHALKAILHDKHISTAVGDEGGFAPSVENHEAALQLILQAIDKAGYTAGDQIALG
LDCAASEFYKDGKYVLEGEGGIALTAEQWTDMLAAWCDKYPIISIEDGMAEGDWDGWKVL
TDRLASKVQLVGDDLFVTNTKILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGY
TAVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDVAVYPG
RDAFYNLK