Protein Info for GFF5437 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Periplasmic molybdate-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00126: HTH_1" amino acids 41 to 97 (57 residues), 39.9 bits, see alignment E=4.9e-14 PF12727: PBP_like" amino acids 165 to 352 (188 residues), 187 bits, see alignment E=3.1e-59 PF12974: Phosphonate-bd" amino acids 182 to 315 (134 residues), 27.1 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: None (inferred from 61% identity to ajs:Ajs_3130)

Predicted SEED Role

"Periplasmic molybdate-binding domain" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF5437 Periplasmic molybdate-binding domain (Hydrogenophaga sp. GW460-11-11-14-LB1)
VATLFRAHSASMRKIELSYTLTPPTPERSPHPALLRNPMMDVLHALRTSGSISGAARELG
LSYRHVWGQLKDWEAGLGQQLIFWERGQAARLTPFGERLLMAERLAQARLGPQMENLRAE
LERAFAMAFEEGQHASTGDVLTLYASHDHALTELQQHASTATEGRHAAPPLHMDIRFCGS
VDAIRALNEGRCELAGFHTQPFAAAGSLSARAYRPLLKPGLHKIIGFARRSQGLMVAPGN
PLRLGDIGDVSRLQARFVNRAIGTGTRLLLDELLAQATLLPMDIVGYHNVESSHAAVAQA
VASGSADVGLGTEYAARAQGLGFVPLTEERYLLVCLKSALEQPALQRLLQRLRSRAWQER
LNALPGYAADHCGEVAAMKRLLPWWD