Protein Info for GFF5435 in Variovorax sp. SCN45

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF02353: CMAS" amino acids 134 to 399 (266 residues), 271.7 bits, see alignment E=2.1e-84 PF13489: Methyltransf_23" amino acids 180 to 340 (161 residues), 49.8 bits, see alignment E=1e-16 PF13847: Methyltransf_31" amino acids 191 to 306 (116 residues), 43 bits, see alignment E=1.1e-14 PF13649: Methyltransf_25" amino acids 196 to 287 (92 residues), 64.7 bits, see alignment E=3.2e-21 PF08241: Methyltransf_11" amino acids 197 to 290 (94 residues), 56.7 bits, see alignment E=9.7e-19 PF08242: Methyltransf_12" amino acids 197 to 288 (92 residues), 44.7 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 93% identity to vpe:Varpa_5884)

MetaCyc: 44% identical to cis-vaccenate 11-methyltransferase (Cereibacter sphaeroides)
2.1.1.-

Predicted SEED Role

"S-adenosyl-L-methionine dependent methyltransferase, similar to cyclopropane-fatty-acyl-phospholipid synthase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>GFF5435 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type (Variovorax sp. SCN45)
MTSTSTTASRFSLPQDAPGAARTVLGLLQRLAYGSLTVRLPDDSVRHFGATPGSGPTASL
TLRNWNVCKAALKSGDIGFAESYIAGDWTTPNLTELIKVFIANRRAIEDVVYGSWFGRLL
YRVRHIMNRNSKAGSSRNIHAHYDLGNAFYKLWLDETMNYSSAWFEGDLSKPMPEAQRAK
VRRALELAAVKPGDRVLEIGCGWGALAEMAAVDFGASVTGVTLSTEQLAFAQQRTAGLRA
DLRLQDYRDISDAPFDAVCSIEMVEAVGREYWPTYFQSVSRLLKPGGRACVQSIVIDDEL
FDRYIDSTDFIQQYIFPGGCLPCPREFRREAEAAGLEVVDEFAFGADYAETLRRWRESFL
GQRGQILQLGFDERFMRIWEFYLAYCEAAFSQANIDVVQYTLRKR