Protein Info for PS417_27785 in Pseudomonas simiae WCS417

Annotation: phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 15 to 144 (130 residues), 122.5 bits, E=2.2e-39
• PF02879: PGM_PMM_II
  • amino acids 160 to 257 (98 residues), 106 bits, E=2.7e-34
• PF02880: PGM_PMM_III
  • amino acids 262 to 368 (107 residues), 86.5 bits, E=3e-28
• PF00408: PGM_PMM_IV
  • amino acids 377 to 449 (73 residues), 57.1 bits, E=3e-19

Best Hits

Swiss-Prot: 82% identical to ALGC_PSESM: Phosphomannomutase/phosphoglucomutase (algC) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU5986)

MetaCyc: 78% identical to phosphomannomutase (Pseudomonas aeruginosa)
Phosphomannomutase. [EC: 5.4.2.8]; Phosphoglucomutase. [EC: 5.4.2.8, 5.4.2.2]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucomutase (EC 5.4.2.2)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.2, EC 5.4.2.8)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• starch degradation III (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (6/14 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See A0A1N7UJN0 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PS417_27785 phosphoglucomutase (Pseudomonas simiae WCS417)
MSTAARVVPTFPDSIFRAYDIRGVVPKTLTAETAYWIGRAIGSQSLAQDEPNVSVGRDGR
LSGPELVEQLIQGLADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALHDRLKNNDLTSGKGTVTKVDILQRYSDEITRDVKLARRLKVVVD
CGNGAAGVIAPQLLEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETGADVG
LAFDGDGDRVGVVTETGEIVFPDRLLMLFARDVVARNANAEIIFDVKCTRRLTPLIKEYG
GRPLMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFQTFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGANLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADTEAELQRIKDVFHAQLKRVAPDLQLPF