Protein Info for GFF5424 in Variovorax sp. SCN45

Annotation: Membrane protein TerC, possibly involved in tellurium resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 12 to 192 (181 residues), 246.6 bits, see alignment E=6.3e-78 PF03741: TerC" amino acids 15 to 191 (177 residues), 174.7 bits, see alignment E=8.3e-56

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_5894)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF5424 Membrane protein TerC, possibly involved in tellurium resistance (Variovorax sp. SCN45)
MELFMAPEFWVAVGQIIMIDILLGGDNAVVIALACRKLPPHQRTKGILWGTAGAIILRVI
LIFFALTLLAIPFLKLVGAILLVWIGVKLLAPEHDDAHGNITGSDKLWGAVKTVIIADLV
MSVDNVIAIAGAAQGAGEGHQMPLVIFGLLVSIPIIVWGSQLVIKLMDKFPMIITAGGML
LGWIAGTMAVSDPALANAAAWTWVPKVPQTDTIKYAAGIGGALLVLAVGKWVAARQARNK
PETPVTTG