Protein Info for PS417_27745 in Pseudomonas simiae WCS417
Updated annotation (from data): gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.99); 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54)
Rationale: Specifically important for putrescine utilization as part of the gamma-glutamylputrescine pathway. Similar to the 4-guanidinobutyraldehyde dehydrogenase from P. putida (kauB), which is involved in arginine catabolism, and 92% identical to AO356_12580, which is also involved in arginine catabolism. Mutants in PS417_27745 seem to have a very subtle defect in arginine catabolism; it probably has both activities.
Original annotation: aldehyde dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to AL1A2_MOUSE: Retinal dehydrogenase 2 (Aldh1a2) from Mus musculus
KEGG orthology group: K12254, 4-guanidinobutyraldehyde dehydrogenase / NAD-dependent aldehyde dehydrogenase [EC: 1.2.1.- 1.2.1.54] (inferred from 98% identity to pfs:PFLU5976)MetaCyc: 87% identical to 4-guanidinobutyraldehyde dehydrogenase (Pseudomonas putida)
Gamma-guanidinobutyraldehyde dehydrogenase. [EC: 1.2.1.54]
Predicted SEED Role
"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)
MetaCyc Pathways
- superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation IV (3/3 steps found)
- superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
- putrescine degradation V (2/2 steps found)
- mitochondrial NADPH production (yeast) (4/5 steps found)
- octane oxidation (4/5 steps found)
- superpathway of ornithine degradation (6/8 steps found)
- L-arginine degradation IX (arginine:pyruvate transaminase pathway) (3/4 steps found)
- L-arginine degradation VIII (arginine oxidase pathway) (3/4 steps found)
- phytol degradation (3/4 steps found)
- putrescine degradation II (3/4 steps found)
- superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- ethanol degradation III (2/3 steps found)
- hypotaurine degradation (2/3 steps found)
- putrescine degradation IV (2/3 steps found)
- ethylene glycol degradation (1/2 steps found)
- putrescine degradation I (1/2 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
- D-arabinose degradation II (2/4 steps found)
- fatty acid α-oxidation I (plants) (2/4 steps found)
- putrescine degradation III (2/4 steps found)
- histamine degradation (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
- serotonin degradation (3/7 steps found)
- dopamine degradation (1/5 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- alkane oxidation (1/6 steps found)
- aromatic biogenic amine degradation (bacteria) (2/8 steps found)
- limonene degradation IV (anaerobic) (1/7 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
- superpathway of pentose and pentitol degradation (16/42 steps found)
KEGG Metabolic Maps
- 1,2-Dichloroethane degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Arginine and proline metabolism
- Ascorbate and aldarate metabolism
- Butanoate metabolism
- Fatty acid metabolism
- Geraniol degradation
- Glycerolipid metabolism
- Glycolysis / Gluconeogenesis
- Histidine metabolism
- Limonene and pinene degradation
- Lysine biosynthesis
- Lysine degradation
- Naphthalene and anthracene degradation
- Propanoate metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
- Valine, leucine and isoleucine degradation
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.-, 1.2.1.3
Use Curated BLAST to search for 1.2.1.- or 1.2.1.3 or 1.2.1.54 or 1.2.1.99
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UQP5 at UniProt or InterPro
Protein Sequence (497 amino acids)
>PS417_27745 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.99); 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (Pseudomonas simiae WCS417) MTTLTRADWEQRAKDLKIEGRAYINGEYTAAVSGDTFECISPVDGRLLATVASCDAADAQ RAVENARATFNSGVWSRLAPAKRKSAMLRFAALLKANAEELALLETLDMGKPISDSLNID VPGAANALSWSGEAIDKIYDEVAATPHDQLGLVTREPVGVVGAIVPWNFPLMMACWKLGP ALSTGNSVILKPSEKSPLTAIRIAALAVEAGIPKGVFNVLPGYGHTVGNALALHMDVDTL VFTGSTKIAKQLLIRSGESNMKRVWLEAGGKSPNIVFADAPDLQAAAESAAGAIAFNQGE VCTAGSRLLVERSIKDKFLPLVIEALKGWKPGNPLDPATNVGALVDTQQMNTVLSYIEAG HADGAKLVAGGKRTLEETGGTYVEPTIFDGVTNAMKIAKEEIFGPVLSVITFDSAEEAVA IANDTIYGLAAAVWTADISKAHLTAKALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKS LHAFDKYTELKATWIKL